Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4525324..4525943 | Replicon | chromosome |
| Accession | NZ_CP116214 | ||
| Organism | Klebsiella michiganensis strain 2563 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H3N9D8 |
| Locus tag | PHA56_RS21375 | Protein ID | WP_004099646.1 |
| Coordinates | 4525725..4525943 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | H3N7X7 |
| Locus tag | PHA56_RS21370 | Protein ID | WP_004129911.1 |
| Coordinates | 4525324..4525698 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA56_RS21360 (PHA56_21360) | 4520481..4521674 | + | 1194 | WP_004136054.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PHA56_RS21365 (PHA56_21365) | 4521697..4524843 | + | 3147 | WP_221686856.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| PHA56_RS21370 (PHA56_21370) | 4525324..4525698 | + | 375 | WP_004129911.1 | Hha toxicity modulator TomB | Antitoxin |
| PHA56_RS21375 (PHA56_21375) | 4525725..4525943 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
| PHA56_RS21380 (PHA56_21380) | 4526106..4526672 | + | 567 | WP_038424164.1 | maltose O-acetyltransferase | - |
| PHA56_RS21385 (PHA56_21385) | 4526644..4526778 | - | 135 | WP_223226764.1 | hypothetical protein | - |
| PHA56_RS21390 (PHA56_21390) | 4526799..4527269 | + | 471 | WP_014228205.1 | YlaC family protein | - |
| PHA56_RS21395 (PHA56_21395) | 4527244..4528698 | - | 1455 | WP_038424163.1 | PLP-dependent aminotransferase family protein | - |
| PHA56_RS21400 (PHA56_21400) | 4528800..4529498 | + | 699 | WP_014228203.1 | GNAT family protein | - |
| PHA56_RS21405 (PHA56_21405) | 4529495..4529635 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| PHA56_RS21410 (PHA56_21410) | 4529635..4529898 | - | 264 | WP_004848323.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T268458 WP_004099646.1 NZ_CP116214:4525725-4525943 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT268458 WP_004129911.1 NZ_CP116214:4525324-4525698 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H713 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3HD25 |