Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 2055293..2055883 | Replicon | chromosome |
| Accession | NZ_CP116214 | ||
| Organism | Klebsiella michiganensis strain 2563 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A0H3HDW1 |
| Locus tag | PHA56_RS09760 | Protein ID | WP_014229979.1 |
| Coordinates | 2055551..2055883 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | J6I3K7 |
| Locus tag | PHA56_RS09755 | Protein ID | WP_004852307.1 |
| Coordinates | 2055293..2055550 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA56_RS09730 (PHA56_09735) | 2050549..2051154 | - | 606 | WP_032750440.1 | glutathione S-transferase family protein | - |
| PHA56_RS09735 (PHA56_09740) | 2051334..2052260 | + | 927 | WP_014229983.1 | LysR substrate-binding domain-containing protein | - |
| PHA56_RS09740 (PHA56_09745) | 2052298..2053296 | - | 999 | WP_014229982.1 | aldo/keto reductase | - |
| PHA56_RS09745 (PHA56_09750) | 2053397..2054311 | + | 915 | WP_014229981.1 | LysR family transcriptional regulator | - |
| PHA56_RS09750 (PHA56_09755) | 2054502..2054582 | - | 81 | Protein_1911 | molybdopterin-binding protein | - |
| PHA56_RS09755 (PHA56_09760) | 2055293..2055550 | + | 258 | WP_004852307.1 | antitoxin | Antitoxin |
| PHA56_RS09760 (PHA56_09765) | 2055551..2055883 | + | 333 | WP_014229979.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PHA56_RS09770 (PHA56_09775) | 2056206..2057663 | + | 1458 | WP_014229916.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| PHA56_RS09780 (PHA56_09785) | 2058626..2060080 | - | 1455 | WP_014229909.1 | AMP nucleosidase | - |
| PHA56_RS09785 (PHA56_09790) | 2060213..2060470 | - | 258 | WP_014229908.1 | histidine kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2045586..2055883 | 10297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11740.57 Da Isoelectric Point: 10.1863
>T268453 WP_014229979.1 NZ_CP116214:2055551-2055883 [Klebsiella michiganensis]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVSLEGAGTKTTGVIRCDQPRTI
DMAARNGKRLESIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVSLEGAGTKTTGVIRCDQPRTI
DMAARNGKRLESIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3HDW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3HDW8 |