Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1327495..1328278 | Replicon | chromosome |
| Accession | NZ_CP116214 | ||
| Organism | Klebsiella michiganensis strain 2563 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | PHA56_RS06390 | Protein ID | WP_039077579.1 |
| Coordinates | 1327495..1327869 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PHA56_RS06395 | Protein ID | WP_039077578.1 |
| Coordinates | 1327919..1328278 (-) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA56_RS06365 (PHA56_06365) | 1322949..1323857 | + | 909 | WP_032938037.1 | kdo(2)-lipid IV(A) palmitoleoyltransferase | - |
| PHA56_RS06370 (PHA56_06370) | 1324631..1325104 | + | 474 | WP_228291928.1 | glycosyltransferase family 2 protein | - |
| PHA56_RS06375 (PHA56_06375) | 1325180..1326408 | + | 1229 | WP_104159316.1 | IS3 family transposase | - |
| PHA56_RS06380 (PHA56_06380) | 1326393..1326956 | + | 564 | WP_228291929.1 | hypothetical protein | - |
| PHA56_RS06385 (PHA56_06385) | 1326960..1327418 | + | 459 | WP_224232182.1 | hypothetical protein | - |
| PHA56_RS06390 (PHA56_06390) | 1327495..1327869 | - | 375 | WP_039077579.1 | TA system toxin CbtA family protein | Toxin |
| PHA56_RS06395 (PHA56_06395) | 1327919..1328278 | - | 360 | WP_039077578.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PHA56_RS06400 (PHA56_06400) | 1328301..1328522 | - | 222 | WP_032938028.1 | DUF987 domain-containing protein | - |
| PHA56_RS06405 (PHA56_06405) | 1328536..1329018 | - | 483 | WP_039077577.1 | DNA repair protein RadC | - |
| PHA56_RS06410 (PHA56_06410) | 1329259..1329738 | - | 480 | WP_082027055.1 | antirestriction protein | - |
| PHA56_RS06415 (PHA56_06415) | 1329818..1330639 | - | 822 | WP_039077576.1 | DUF932 domain-containing protein | - |
| PHA56_RS06420 (PHA56_06420) | 1330750..1330962 | - | 213 | WP_032938024.1 | hypothetical protein | - |
| PHA56_RS06425 (PHA56_06425) | 1331072..1331545 | - | 474 | WP_032938022.1 | hypothetical protein | - |
| PHA56_RS06430 (PHA56_06430) | 1331619..1332248 | - | 630 | WP_039077575.1 | hypothetical protein | - |
| PHA56_RS06435 (PHA56_06435) | 1332346..1333023 | - | 678 | WP_039077574.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1297582..1349493 | 51911 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13875.91 Da Isoelectric Point: 10.3681
>T268452 WP_039077579.1 NZ_CP116214:c1327869-1327495 [Klebsiella michiganensis]
MQKQSLSPHRAASSRLSSVEIWRKLLKYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCYAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSIDMLRARKATGLMTRKGYKTVTDISGGRSSGGK
MQKQSLSPHRAASSRLSSVEIWRKLLKYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCYAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSIDMLRARKATGLMTRKGYKTVTDISGGRSSGGK
Download Length: 375 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13317.39 Da Isoelectric Point: 7.4144
>AT268452 WP_039077578.1 NZ_CP116214:c1328278-1327919 [Klebsiella michiganensis]
MQKATRVINHNIAEPWWGLRRNITPCFGARLVHEGNHLHYLADRASIAGTFNDADLRHLDQAFPVLMKQMELMLTSSELT
PHIQRCITLHAKGLICEADTLGSCGYLYIVIYPASATTA
MQKATRVINHNIAEPWWGLRRNITPCFGARLVHEGNHLHYLADRASIAGTFNDADLRHLDQAFPVLMKQMELMLTSSELT
PHIQRCITLHAKGLICEADTLGSCGYLYIVIYPASATTA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|