Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 846427..847084 | Replicon | chromosome |
| Accession | NZ_CP116214 | ||
| Organism | Klebsiella michiganensis strain 2563 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | J5U333 |
| Locus tag | PHA56_RS04095 | Protein ID | WP_004854060.1 |
| Coordinates | 846674..847084 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | H3N295 |
| Locus tag | PHA56_RS04090 | Protein ID | WP_004124953.1 |
| Coordinates | 846427..846693 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA56_RS04075 (PHA56_04075) | 841661..842086 | - | 426 | WP_032720093.1 | PTS sugar transporter subunit IIA | - |
| PHA56_RS04080 (PHA56_04080) | 842207..845005 | - | 2799 | WP_014226794.1 | transcriptional regulator DagR | - |
| PHA56_RS04085 (PHA56_04085) | 845199..846182 | - | 984 | WP_032720095.1 | tRNA-modifying protein YgfZ | - |
| PHA56_RS04090 (PHA56_04090) | 846427..846693 | + | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
| PHA56_RS04095 (PHA56_04095) | 846674..847084 | + | 411 | WP_004854060.1 | protein YgfX | Toxin |
| PHA56_RS04100 (PHA56_04100) | 847093..847614 | - | 522 | WP_014226792.1 | flavodoxin FldB | - |
| PHA56_RS04105 (PHA56_04105) | 847736..848632 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
| PHA56_RS04110 (PHA56_04110) | 848655..849368 | + | 714 | WP_004854054.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PHA56_RS04115 (PHA56_04115) | 849374..851107 | + | 1734 | WP_038423602.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16106.97 Da Isoelectric Point: 10.9455
>T268451 WP_004854060.1 NZ_CP116214:846674-847084 [Klebsiella michiganensis]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYA5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H3L9 |