Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 691036..691739 | Replicon | chromosome |
Accession | NZ_CP116214 | ||
Organism | Klebsiella michiganensis strain 2563 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | PHA56_RS03330 | Protein ID | WP_119834388.1 |
Coordinates | 691398..691739 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | PHA56_RS03325 | Protein ID | WP_119834410.1 |
Coordinates | 691036..691377 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA56_RS03285 (PHA56_03285) | 686588..687292 | + | 705 | WP_119834393.1 | WYL domain-containing protein | - |
PHA56_RS03290 (PHA56_03290) | 687292..687861 | + | 570 | WP_119834392.1 | hypothetical protein | - |
PHA56_RS03295 (PHA56_03295) | 687876..688328 | + | 453 | WP_100168667.1 | hypothetical protein | - |
PHA56_RS03300 (PHA56_03300) | 688325..688774 | + | 450 | WP_071199563.1 | IrmA family protein | - |
PHA56_RS03305 (PHA56_03305) | 688846..689076 | + | 231 | WP_119834391.1 | DUF905 domain-containing protein | - |
PHA56_RS03310 (PHA56_03310) | 689175..689996 | + | 822 | WP_119834390.1 | DUF932 domain-containing protein | - |
PHA56_RS03315 (PHA56_03315) | 690027..690470 | + | 444 | WP_025205062.1 | antirestriction protein | - |
PHA56_RS03320 (PHA56_03320) | 690483..691025 | + | 543 | WP_119834389.1 | DNA repair protein RadC | - |
PHA56_RS03325 (PHA56_03325) | 691036..691377 | + | 342 | WP_119834410.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PHA56_RS03330 (PHA56_03330) | 691398..691739 | + | 342 | WP_119834388.1 | TA system toxin CbtA family protein | Toxin |
PHA56_RS03340 (PHA56_03340) | 692101..692607 | + | 507 | WP_009651862.1 | G/U mismatch-specific DNA glycosylase | - |
PHA56_RS03345 (PHA56_03345) | 692677..693339 | - | 663 | WP_032692890.1 | TetR/AcrR family transcriptional regulator | - |
PHA56_RS03350 (PHA56_03350) | 693580..695424 | - | 1845 | WP_004105908.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12850.81 Da Isoelectric Point: 9.6542
>T268450 WP_119834388.1 NZ_CP116214:691398-691739 [Klebsiella michiganensis]
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVDKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLRRSRNNAVS
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVDKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLRRSRNNAVS
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|