Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2475356..2476331 | Replicon | chromosome |
Accession | NZ_CP116204 | ||
Organism | Bacillus paranthracis strain NVH_0075/95 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | B7HS47 |
Locus tag | PGS39_RS12815 | Protein ID | WP_002027714.1 |
Coordinates | 2475356..2476093 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | R8HWP4 |
Locus tag | PGS39_RS12820 | Protein ID | WP_000588712.1 |
Coordinates | 2476206..2476331 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGS39_RS12785 (PGS39_12785) | 2470431..2471141 | + | 711 | WP_000787481.1 | class I SAM-dependent methyltransferase | - |
PGS39_RS12790 (PGS39_12790) | 2471261..2471668 | + | 408 | WP_000072484.1 | VOC family protein | - |
PGS39_RS12795 (PGS39_12795) | 2471774..2471866 | + | 93 | Protein_2440 | methyltransferase | - |
PGS39_RS12800 (PGS39_12800) | 2471988..2473673 | - | 1686 | WP_002027713.1 | alpha-keto acid decarboxylase family protein | - |
PGS39_RS12805 (PGS39_12805) | 2473780..2474262 | + | 483 | WP_000191904.1 | MarR family transcriptional regulator | - |
PGS39_RS12810 (PGS39_12810) | 2474430..2475167 | + | 738 | WP_000594123.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
PGS39_RS12815 (PGS39_12815) | 2475356..2476093 | + | 738 | WP_002027714.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
PGS39_RS12820 (PGS39_12820) | 2476206..2476331 | + | 126 | WP_000588712.1 | hypothetical protein | Antitoxin |
PGS39_RS12825 (PGS39_12825) | 2476407..2476583 | + | 177 | WP_000852618.1 | stage II sporulation protein SB | - |
PGS39_RS12830 (PGS39_12830) | 2476727..2478196 | + | 1470 | WP_000287521.1 | beta-Ala-His dipeptidase | - |
PGS39_RS12835 (PGS39_12835) | 2478273..2478644 | - | 372 | WP_000670600.1 | DUF5065 family protein | - |
PGS39_RS12840 (PGS39_12840) | 2478787..2479380 | + | 594 | WP_000265892.1 | SGNH/GDSL hydrolase family protein | - |
PGS39_RS12845 (PGS39_12845) | 2479602..2480135 | + | 534 | WP_000438318.1 | sigma-70 family RNA polymerase sigma factor | - |
PGS39_RS12850 (PGS39_12850) | 2480125..2480952 | + | 828 | WP_001060779.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28415.15 Da Isoelectric Point: 8.2672
>T268447 WP_002027714.1 NZ_CP116204:2475356-2476093 [Bacillus paranthracis]
VISNIRIGLFILAIVFLILVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTSIIQNVNPVVFGTMEWHTEEEYTKSLNVFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
VISNIRIGLFILAIVFLILVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTSIIQNVNPVVFGTMEWHTEEEYTKSLNVFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5M9H7T3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366GQT1 |