Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 249440..250082 | Replicon | chromosome |
| Accession | NZ_CP116204 | ||
| Organism | Bacillus paranthracis strain NVH_0075/95 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | J8CWW5 |
| Locus tag | PGS39_RS01395 | Protein ID | WP_000635963.1 |
| Coordinates | 249732..250082 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | PGS39_RS01390 | Protein ID | WP_000004570.1 |
| Coordinates | 249440..249727 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGS39_RS01365 (PGS39_01365) | 244764..245726 | + | 963 | WP_000961151.1 | UV DNA damage repair endonuclease UvsE | - |
| PGS39_RS01370 (PGS39_01370) | 245719..246291 | - | 573 | WP_000906919.1 | rhomboid family intramembrane serine protease | - |
| PGS39_RS01375 (PGS39_01375) | 246384..246743 | + | 360 | WP_000635037.1 | holo-ACP synthase | - |
| PGS39_RS01380 (PGS39_01380) | 246900..247850 | + | 951 | WP_025991724.1 | outer membrane lipoprotein carrier protein LolA | - |
| PGS39_RS01385 (PGS39_01385) | 247969..249138 | + | 1170 | WP_000390601.1 | alanine racemase | - |
| PGS39_RS01390 (PGS39_01390) | 249440..249727 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| PGS39_RS01395 (PGS39_01395) | 249732..250082 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| PGS39_RS01400 (PGS39_01400) | 250150..252318 | + | 2169 | WP_000450602.1 | Tex family protein | - |
| PGS39_RS01405 (PGS39_01405) | 252376..252492 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| PGS39_RS01410 (PGS39_01410) | 252688..253146 | + | 459 | WP_000344246.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T268446 WP_000635963.1 NZ_CP116204:249732-250082 [Bacillus paranthracis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4HKE | |
| PDB | 7BXY |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |