Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 21365..22008 | Replicon | plasmid pDETEC88 |
Accession | NZ_CP116199 | ||
Organism | Escherichia coli strain DETEC-C31 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | PIB97_RS24080 | Protein ID | WP_001044768.1 |
Coordinates | 21592..22008 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | PIB97_RS24075 | Protein ID | WP_001261287.1 |
Coordinates | 21365..21595 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB97_RS24055 (16525) | 16525..17613 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
PIB97_RS24060 (17615) | 17615..19840 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
PIB97_RS24065 (19890) | 19890..20789 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
PIB97_RS24070 (20779) | 20779..21069 | - | 291 | WP_000111771.1 | hypothetical protein | - |
PIB97_RS24075 (21365) | 21365..21595 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PIB97_RS24080 (21592) | 21592..22008 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PIB97_RS24085 (22170) | 22170..24308 | - | 2139 | WP_000350638.1 | AAA family ATPase | - |
PIB97_RS24090 (24662) | 24662..24919 | + | 258 | WP_000343085.1 | hypothetical protein | - |
PIB97_RS24095 (24919) | 24919..25509 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(3')-Ia / blaCTX-M-55 / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..111058 | 111058 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T268433 WP_001044768.1 NZ_CP116199:21592-22008 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |