Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4388004..4388839 Replicon chromosome
Accession NZ_CP116197
Organism Escherichia coli strain DETEC-C31

Toxin (Protein)


Gene name yeeV Uniprot ID A0A5F1UHJ9
Locus tag PIB97_RS20990 Protein ID WP_039023548.1
Coordinates 4388462..4388839 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7LDN9
Locus tag PIB97_RS20985 Protein ID WP_001285607.1
Coordinates 4388004..4388372 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB97_RS20950 (4383896) 4383896..4384576 + 681 WP_001282919.1 WYL domain-containing protein -
PIB97_RS20955 (4384724) 4384724..4385401 + 678 WP_001097301.1 hypothetical protein -
PIB97_RS20960 (4385431) 4385431..4385640 + 210 WP_174402685.1 DUF905 family protein -
PIB97_RS20965 (4385730) 4385730..4386548 + 819 WP_001175175.1 DUF932 domain-containing protein -
PIB97_RS20970 (4386640) 4386640..4387125 + 486 WP_000213722.1 antirestriction protein -
PIB97_RS20975 (4387140) 4387140..4387616 + 477 WP_001384029.1 RadC family protein -
PIB97_RS20980 (4387703) 4387703..4387924 + 222 WP_000692350.1 DUF987 domain-containing protein -
PIB97_RS20985 (4388004) 4388004..4388372 + 369 WP_001285607.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PIB97_RS20990 (4388462) 4388462..4388839 + 378 WP_039023548.1 TA system toxin CbtA family protein Toxin
PIB97_RS20995 (4388836) 4388836..4388985 + 150 Protein_4109 DUF5983 family protein -
PIB97_RS21000 (4389061) 4389061..4389258 + 198 WP_088172489.1 DUF957 domain-containing protein -
PIB97_RS21005 (4389343) 4389343..4390209 + 867 WP_039023551.1 DUF4942 domain-containing protein -
PIB97_RS21010 (4390281) 4390281..4390544 + 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
PIB97_RS21015 (4390541) 4390541..4390867 + 327 WP_000779482.1 type II toxin-antitoxin system RelE/ParE family toxin -
PIB97_RS21020 (4391750) 4391750..4393288 + 1539 WP_001187177.1 lysine decarboxylation/transport transcriptional activator CadC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4376382..4401101 24719


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14088.99 Da        Isoelectric Point: 7.3523

>T268430 WP_039023548.1 NZ_CP116197:4388462-4388839 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13689.53 Da        Isoelectric Point: 6.4669

>AT268430 WP_001285607.1 NZ_CP116197:4388004-4388372 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5F1UHJ9

Antitoxin

Source ID Structure
AlphaFold DB A0A1M0JLU8

References