Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4388004..4388839 | Replicon | chromosome |
Accession | NZ_CP116197 | ||
Organism | Escherichia coli strain DETEC-C31 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A5F1UHJ9 |
Locus tag | PIB97_RS20990 | Protein ID | WP_039023548.1 |
Coordinates | 4388462..4388839 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | B7LDN9 |
Locus tag | PIB97_RS20985 | Protein ID | WP_001285607.1 |
Coordinates | 4388004..4388372 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB97_RS20950 (4383896) | 4383896..4384576 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
PIB97_RS20955 (4384724) | 4384724..4385401 | + | 678 | WP_001097301.1 | hypothetical protein | - |
PIB97_RS20960 (4385431) | 4385431..4385640 | + | 210 | WP_174402685.1 | DUF905 family protein | - |
PIB97_RS20965 (4385730) | 4385730..4386548 | + | 819 | WP_001175175.1 | DUF932 domain-containing protein | - |
PIB97_RS20970 (4386640) | 4386640..4387125 | + | 486 | WP_000213722.1 | antirestriction protein | - |
PIB97_RS20975 (4387140) | 4387140..4387616 | + | 477 | WP_001384029.1 | RadC family protein | - |
PIB97_RS20980 (4387703) | 4387703..4387924 | + | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
PIB97_RS20985 (4388004) | 4388004..4388372 | + | 369 | WP_001285607.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PIB97_RS20990 (4388462) | 4388462..4388839 | + | 378 | WP_039023548.1 | TA system toxin CbtA family protein | Toxin |
PIB97_RS20995 (4388836) | 4388836..4388985 | + | 150 | Protein_4109 | DUF5983 family protein | - |
PIB97_RS21000 (4389061) | 4389061..4389258 | + | 198 | WP_088172489.1 | DUF957 domain-containing protein | - |
PIB97_RS21005 (4389343) | 4389343..4390209 | + | 867 | WP_039023551.1 | DUF4942 domain-containing protein | - |
PIB97_RS21010 (4390281) | 4390281..4390544 | + | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
PIB97_RS21015 (4390541) | 4390541..4390867 | + | 327 | WP_000779482.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
PIB97_RS21020 (4391750) | 4391750..4393288 | + | 1539 | WP_001187177.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4376382..4401101 | 24719 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14088.99 Da Isoelectric Point: 7.3523
>T268430 WP_039023548.1 NZ_CP116197:4388462-4388839 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13689.53 Da Isoelectric Point: 6.4669
>AT268430 WP_001285607.1 NZ_CP116197:4388004-4388372 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5F1UHJ9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0JLU8 |