Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4201496..4202331 | Replicon | chromosome |
Accession | NZ_CP116197 | ||
Organism | Escherichia coli strain DETEC-C31 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A5F1UHJ9 |
Locus tag | PIB97_RS20010 | Protein ID | WP_039023548.1 |
Coordinates | 4201496..4201873 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | B7LDN9 |
Locus tag | PIB97_RS20015 | Protein ID | WP_001285607.1 |
Coordinates | 4201963..4202331 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB97_RS19990 (4197019) | 4197019..4199910 | - | 2892 | WP_021557482.1 | SNF2-related protein | - |
PIB97_RS19995 (4200566) | 4200566..4200709 | - | 144 | Protein_3914 | hypothetical protein | - |
PIB97_RS20000 (4200794) | 4200794..4200991 | - | 198 | WP_001327226.1 | DUF957 domain-containing protein | - |
PIB97_RS20005 (4201011) | 4201011..4201499 | - | 489 | WP_000761685.1 | DUF5983 family protein | - |
PIB97_RS20010 (4201496) | 4201496..4201873 | - | 378 | WP_039023548.1 | TA system toxin CbtA family protein | Toxin |
PIB97_RS20015 (4201963) | 4201963..4202331 | - | 369 | WP_001285607.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PIB97_RS20020 (4202411) | 4202411..4202632 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
PIB97_RS20025 (4202719) | 4202719..4203195 | - | 477 | WP_001384029.1 | RadC family protein | - |
PIB97_RS20030 (4203210) | 4203210..4203695 | - | 486 | WP_000213722.1 | antirestriction protein | - |
PIB97_RS20035 (4203787) | 4203787..4204605 | - | 819 | WP_001175175.1 | DUF932 domain-containing protein | - |
PIB97_RS20040 (4204695) | 4204695..4204904 | - | 210 | WP_174402685.1 | DUF905 family protein | - |
PIB97_RS20045 (4204934) | 4204934..4205611 | - | 678 | WP_001097301.1 | hypothetical protein | - |
PIB97_RS20050 (4205759) | 4205759..4206439 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14088.99 Da Isoelectric Point: 7.3523
>T268428 WP_039023548.1 NZ_CP116197:c4201873-4201496 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13689.53 Da Isoelectric Point: 6.4669
>AT268428 WP_001285607.1 NZ_CP116197:c4202331-4201963 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5F1UHJ9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0JLU8 |