Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3479846..3480464 | Replicon | chromosome |
Accession | NZ_CP116197 | ||
Organism | Escherichia coli strain DETEC-C31 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PIB97_RS16605 | Protein ID | WP_001291435.1 |
Coordinates | 3480246..3480464 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PIB97_RS16600 | Protein ID | WP_000344800.1 |
Coordinates | 3479846..3480220 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB97_RS16590 (3474935) | 3474935..3476128 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PIB97_RS16595 (3476151) | 3476151..3479300 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PIB97_RS16600 (3479846) | 3479846..3480220 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PIB97_RS16605 (3480246) | 3480246..3480464 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PIB97_RS16610 (3480635) | 3480635..3481186 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
PIB97_RS16615 (3481302) | 3481302..3481772 | + | 471 | WP_000136192.1 | YlaC family protein | - |
PIB97_RS16620 (3481936) | 3481936..3483486 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PIB97_RS16625 (3483528) | 3483528..3483881 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
PIB97_RS16635 (3484260) | 3484260..3484571 | + | 312 | WP_000409911.1 | MGMT family protein | - |
PIB97_RS16640 (3484602) | 3484602..3485174 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T268425 WP_001291435.1 NZ_CP116197:3480246-3480464 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT268425 WP_000344800.1 NZ_CP116197:3479846-3480220 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |