Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1876935..1877703 Replicon chromosome
Accession NZ_CP116197
Organism Escherichia coli strain DETEC-C31

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag PIB97_RS08940 Protein ID WP_000854814.1
Coordinates 1876935..1877309 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag PIB97_RS08945 Protein ID WP_174402693.1
Coordinates 1877398..1877703 (-) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB97_RS08900 (1872331) 1872331..1873497 + 1167 WP_271290933.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
PIB97_RS08905 (1873616) 1873616..1874089 + 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
PIB97_RS08910 (1874287) 1874287..1875345 + 1059 WP_085668766.1 FUSC family protein -
PIB97_RS08915 (1875517) 1875517..1875846 + 330 WP_000450409.1 DUF496 family protein -
PIB97_RS08920 (1875947) 1875947..1876081 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
PIB97_RS08925 (1876201) 1876201..1876329 + 129 Protein_1745 transposase domain-containing protein -
PIB97_RS08930 (1876618) 1876618..1876698 - 81 Protein_1746 hypothetical protein -
PIB97_RS08935 (1876744) 1876744..1876938 - 195 WP_000988600.1 DUF5983 family protein -
PIB97_RS08940 (1876935) 1876935..1877309 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
PIB97_RS08945 (1877398) 1877398..1877703 - 306 WP_174402693.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PIB97_RS08950 (1877842) 1877842..1878063 - 222 WP_000692318.1 DUF987 domain-containing protein -
PIB97_RS08955 (1878132) 1878132..1878608 - 477 WP_001186725.1 RadC family protein -
PIB97_RS08960 (1878624) 1878624..1879103 - 480 WP_000860087.1 antirestriction protein -
PIB97_RS08965 (1879185) 1879185..1880003 - 819 WP_174402631.1 DUF932 domain-containing protein -
PIB97_RS08970 (1880103) 1880103..1880336 - 234 WP_032173243.1 DUF905 family protein -
PIB97_RS08975 (1880415) 1880415..1880870 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(2-96)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T268419 WP_000854814.1 NZ_CP116197:c1877309-1876935 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 11294.04 Da        Isoelectric Point: 7.2884

>AT268419 WP_174402693.1 NZ_CP116197:c1877703-1877398 [Escherichia coli]
MPCTVTPFFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKA
DTLSSCGYVYLAVYPTPEMKN

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure

References