Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1876935..1877703 | Replicon | chromosome |
| Accession | NZ_CP116197 | ||
| Organism | Escherichia coli strain DETEC-C31 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | PIB97_RS08940 | Protein ID | WP_000854814.1 |
| Coordinates | 1876935..1877309 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PIB97_RS08945 | Protein ID | WP_174402693.1 |
| Coordinates | 1877398..1877703 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB97_RS08900 (1872331) | 1872331..1873497 | + | 1167 | WP_271290933.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| PIB97_RS08905 (1873616) | 1873616..1874089 | + | 474 | WP_001105393.1 | DNA gyrase inhibitor SbmC | - |
| PIB97_RS08910 (1874287) | 1874287..1875345 | + | 1059 | WP_085668766.1 | FUSC family protein | - |
| PIB97_RS08915 (1875517) | 1875517..1875846 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| PIB97_RS08920 (1875947) | 1875947..1876081 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| PIB97_RS08925 (1876201) | 1876201..1876329 | + | 129 | Protein_1745 | transposase domain-containing protein | - |
| PIB97_RS08930 (1876618) | 1876618..1876698 | - | 81 | Protein_1746 | hypothetical protein | - |
| PIB97_RS08935 (1876744) | 1876744..1876938 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| PIB97_RS08940 (1876935) | 1876935..1877309 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| PIB97_RS08945 (1877398) | 1877398..1877703 | - | 306 | WP_174402693.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PIB97_RS08950 (1877842) | 1877842..1878063 | - | 222 | WP_000692318.1 | DUF987 domain-containing protein | - |
| PIB97_RS08955 (1878132) | 1878132..1878608 | - | 477 | WP_001186725.1 | RadC family protein | - |
| PIB97_RS08960 (1878624) | 1878624..1879103 | - | 480 | WP_000860087.1 | antirestriction protein | - |
| PIB97_RS08965 (1879185) | 1879185..1880003 | - | 819 | WP_174402631.1 | DUF932 domain-containing protein | - |
| PIB97_RS08970 (1880103) | 1880103..1880336 | - | 234 | WP_032173243.1 | DUF905 family protein | - |
| PIB97_RS08975 (1880415) | 1880415..1880870 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T268419 WP_000854814.1 NZ_CP116197:c1877309-1876935 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|