Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | rnlAB/RnlA-RnlB |
Location | 1219665..1221090 | Replicon | chromosome |
Accession | NZ_CP116197 | ||
Organism | Escherichia coli strain DETEC-C31 |
Toxin (Protein)
Gene name | rnlA | Uniprot ID | - |
Locus tag | PIB97_RS05910 | Protein ID | WP_024190590.1 |
Coordinates | 1219665..1220735 (+) | Length | 357 a.a. |
Antitoxin (Protein)
Gene name | rnlB | Uniprot ID | E6BSF0 |
Locus tag | PIB97_RS05915 | Protein ID | WP_000461705.1 |
Coordinates | 1220728..1221090 (+) | Length | 121 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB97_RS05895 (1215282) | 1215282..1218680 | + | 3399 | WP_175098299.1 | prophage tail fiber N-terminal domain-containing protein | - |
PIB97_RS05900 (1218680) | 1218680..1219264 | + | 585 | WP_088183797.1 | tail fiber assembly protein | - |
PIB97_RS05905 (1219334) | 1219334..1219530 | + | 197 | Protein_1155 | recombinase family protein | - |
PIB97_RS05910 (1219665) | 1219665..1220735 | + | 1071 | WP_024190590.1 | type II toxin-antitoxin system RnlA family toxin | Toxin |
PIB97_RS05915 (1220728) | 1220728..1221090 | + | 363 | WP_000461705.1 | type II toxin-antitoxin system RnlB family antitoxin | Antitoxin |
PIB97_RS05920 (1221228) | 1221228..1221497 | - | 270 | WP_000429347.1 | hypothetical protein | - |
PIB97_RS05930 (1222375) | 1222375..1222857 | - | 483 | WP_000162574.1 | SsrA-binding protein SmpB | - |
PIB97_RS05935 (1223028) | 1223028..1223465 | + | 438 | WP_001341638.1 | type II toxin-antitoxin system toxin RatA | - |
PIB97_RS05940 (1223455) | 1223455..1223745 | + | 291 | WP_001117838.1 | RnfH family protein | - |
PIB97_RS05945 (1223807) | 1223807..1224148 | - | 342 | WP_001203437.1 | outer membrane protein assembly factor BamE | - |
PIB97_RS05950 (1224297) | 1224297..1225958 | - | 1662 | WP_000880915.1 | DNA repair protein RecN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 357 a.a. Molecular weight: 40475.40 Da Isoelectric Point: 7.2332
>T268417 WP_024190590.1 NZ_CP116197:1219665-1220735 [Escherichia coli]
MTVRNYTNLNLDRTTIEATSRAFIENKNYSVHSIGPMPGARAGLRVVFAKPGEALATVNIFYNNGGTSTVQYQTGANRNL
GKELADNLYETINPAEFEQVNMVLQGFVEANVLSVLQLSAEQPHIQFYEYLRNTHTTVWKIHSPEFQDELTVSLHHRNGT
LQIQGRPLSCYRVFIFNLSELLDLQGLEKVLIRQDDGKAYIVQKEVARSHLECEMGDAYPLLHKNVEKLLVSGLCVKLAA
PDLPDYCMLLYPELRSVEGVLKSTMYRYGMPITQDGFGPYFDKIGSEFILKQQFGRNLSSAKVKTINDAYTFFNRERHGL
FHMEIVVDTSRMVSDMARLMTKARQAWGIIKDLYIV
MTVRNYTNLNLDRTTIEATSRAFIENKNYSVHSIGPMPGARAGLRVVFAKPGEALATVNIFYNNGGTSTVQYQTGANRNL
GKELADNLYETINPAEFEQVNMVLQGFVEANVLSVLQLSAEQPHIQFYEYLRNTHTTVWKIHSPEFQDELTVSLHHRNGT
LQIQGRPLSCYRVFIFNLSELLDLQGLEKVLIRQDDGKAYIVQKEVARSHLECEMGDAYPLLHKNVEKLLVSGLCVKLAA
PDLPDYCMLLYPELRSVEGVLKSTMYRYGMPITQDGFGPYFDKIGSEFILKQQFGRNLSSAKVKTINDAYTFFNRERHGL
FHMEIVVDTSRMVSDMARLMTKARQAWGIIKDLYIV
Download Length: 1071 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|