Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1036656..1037239 | Replicon | chromosome |
Accession | NZ_CP116197 | ||
Organism | Escherichia coli strain DETEC-C31 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U9XFN8 |
Locus tag | PIB97_RS04970 | Protein ID | WP_000254745.1 |
Coordinates | 1036904..1037239 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A1M2U551 |
Locus tag | PIB97_RS04965 | Protein ID | WP_021557150.1 |
Coordinates | 1036656..1036904 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB97_RS04955 (1032995) | 1032995..1034296 | + | 1302 | WP_021557151.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
PIB97_RS04960 (1034344) | 1034344..1036578 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
PIB97_RS04965 (1036656) | 1036656..1036904 | + | 249 | WP_021557150.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PIB97_RS04970 (1036904) | 1036904..1037239 | + | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
PIB97_RS04975 (1037310) | 1037310..1038101 | + | 792 | WP_001071643.1 | nucleoside triphosphate pyrophosphohydrolase | - |
PIB97_RS04980 (1038329) | 1038329..1039966 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
PIB97_RS04985 (1040054) | 1040054..1041352 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T268416 WP_000254745.1 NZ_CP116197:1036904-1037239 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYM3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M2U551 |