Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 881432..882086 | Replicon | chromosome |
Accession | NZ_CP116197 | ||
Organism | Escherichia coli strain DETEC-C31 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | PIB97_RS04270 | Protein ID | WP_000244777.1 |
Coordinates | 881679..882086 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PIB97_RS04265 | Protein ID | WP_000354046.1 |
Coordinates | 881432..881698 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB97_RS04245 (877520) | 877520..878953 | - | 1434 | WP_271290925.1 | 6-phospho-beta-glucosidase BglA | - |
PIB97_RS04250 (878998) | 878998..879309 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
PIB97_RS04255 (879473) | 879473..880132 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
PIB97_RS04260 (880209) | 880209..881189 | - | 981 | WP_001625883.1 | tRNA-modifying protein YgfZ | - |
PIB97_RS04265 (881432) | 881432..881698 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PIB97_RS04270 (881679) | 881679..882086 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
PIB97_RS04275 (882126) | 882126..882647 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
PIB97_RS04280 (882759) | 882759..883655 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PIB97_RS04285 (883680) | 883680..884390 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PIB97_RS04290 (884396) | 884396..886129 | + | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T268415 WP_000244777.1 NZ_CP116197:881679-882086 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |