Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 100899..101542 | Replicon | plasmid pDETEC3 |
| Accession | NZ_CP116195 | ||
| Organism | Escherichia coli strain DETEC-E1005 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | PIB63_RS24775 | Protein ID | WP_001034044.1 |
| Coordinates | 101126..101542 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | PIB63_RS24770 | Protein ID | WP_001261286.1 |
| Coordinates | 100899..101129 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB63_RS24755 (PIB63_24755) | 96036..96266 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PIB63_RS24760 (PIB63_24760) | 96263..96679 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| PIB63_RS24765 (PIB63_24765) | 96724..100518 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
| PIB63_RS24770 (PIB63_24770) | 100899..101129 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PIB63_RS24775 (PIB63_24775) | 101126..101542 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PIB63_RS24780 (PIB63_24780) | 101617..103182 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| PIB63_RS24785 (PIB63_24785) | 103167..104189 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
| PIB63_RS24795 (PIB63_24795) | 105443..106140 | + | 698 | WP_223155668.1 | IS1-like element IS1A family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mph(A) / blaTEM-1B / tet(B) / dfrA17 / sul2 / aph(3'')-Ib / aph(6)-Id | senB | 1..108065 | 108065 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T268412 WP_001034044.1 NZ_CP116195:101126-101542 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |