Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 91547..92072 | Replicon | plasmid pDETEC3 |
| Accession | NZ_CP116195 | ||
| Organism | Escherichia coli strain DETEC-E1005 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | PIB63_RS24725 | Protein ID | WP_001159868.1 |
| Coordinates | 91547..91852 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | PIB63_RS24730 | Protein ID | WP_000813634.1 |
| Coordinates | 91854..92072 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB63_RS24710 (PIB63_24710) | 87457..88623 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| PIB63_RS24715 (PIB63_24715) | 89211..89966 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| PIB63_RS24720 (PIB63_24720) | 90740..91546 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| PIB63_RS24725 (PIB63_24725) | 91547..91852 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| PIB63_RS24730 (PIB63_24730) | 91854..92072 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| PIB63_RS24735 (PIB63_24735) | 92663..93151 | + | 489 | WP_011254646.1 | hypothetical protein | - |
| PIB63_RS24740 (PIB63_24740) | 93185..94318 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
| PIB63_RS24745 (PIB63_24745) | 94485..95258 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| PIB63_RS24750 (PIB63_24750) | 95271..95771 | - | 501 | WP_001773886.1 | HEPN family nuclease | - |
| PIB63_RS24755 (PIB63_24755) | 96036..96266 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PIB63_RS24760 (PIB63_24760) | 96263..96679 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mph(A) / blaTEM-1B / tet(B) / dfrA17 / sul2 / aph(3'')-Ib / aph(6)-Id | senB | 1..108065 | 108065 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T268410 WP_001159868.1 NZ_CP116195:c91852-91547 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|