Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3607784..3608367 | Replicon | chromosome |
Accession | NZ_CP116194 | ||
Organism | Escherichia coli strain DETEC-E1005 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1PVD8 |
Locus tag | PIB63_RS17705 | Protein ID | WP_000254749.1 |
Coordinates | 3607784..3608119 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | PIB63_RS17710 | Protein ID | WP_000581937.1 |
Coordinates | 3608119..3608367 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB63_RS17690 (3603670) | 3603670..3604968 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
PIB63_RS17695 (3605056) | 3605056..3606693 | - | 1638 | WP_001774030.1 | CTP synthase (glutamine hydrolyzing) | - |
PIB63_RS17700 (3606921) | 3606921..3607712 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
PIB63_RS17705 (3607784) | 3607784..3608119 | - | 336 | WP_000254749.1 | endoribonuclease MazF | Toxin |
PIB63_RS17710 (3608119) | 3608119..3608367 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PIB63_RS17715 (3608445) | 3608445..3610679 | - | 2235 | WP_000226797.1 | GTP diphosphokinase | - |
PIB63_RS17720 (3610727) | 3610727..3612028 | - | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12137.06 Da Isoelectric Point: 8.7218
>T268404 WP_000254749.1 NZ_CP116194:c3608119-3607784 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PVD8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LMB4 |