Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1203092..1203710 | Replicon | chromosome |
| Accession | NZ_CP116194 | ||
| Organism | Escherichia coli strain DETEC-E1005 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | PIB63_RS05780 | Protein ID | WP_001291435.1 |
| Coordinates | 1203092..1203310 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | PIB63_RS05785 | Protein ID | WP_000344800.1 |
| Coordinates | 1203336..1203710 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB63_RS05745 (1198387) | 1198387..1198959 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| PIB63_RS05750 (1198990) | 1198990..1199294 | - | 305 | Protein_1121 | MGMT family protein | - |
| PIB63_RS05760 (1199673) | 1199673..1200026 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| PIB63_RS05765 (1200068) | 1200068..1201618 | - | 1551 | WP_001538392.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| PIB63_RS05770 (1201782) | 1201782..1202252 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| PIB63_RS05775 (1202368) | 1202368..1202919 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| PIB63_RS05780 (1203092) | 1203092..1203310 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| PIB63_RS05785 (1203336) | 1203336..1203710 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| PIB63_RS05790 (1204256) | 1204256..1207405 | - | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| PIB63_RS05795 (1207428) | 1207428..1208621 | - | 1194 | WP_001538394.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T268396 WP_001291435.1 NZ_CP116194:c1203310-1203092 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT268396 WP_000344800.1 NZ_CP116194:c1203710-1203336 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |