Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 96043..96686 Replicon plasmid pDETEC3
Accession NZ_CP116192
Organism Escherichia coli strain DETEC-E1070

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag PIC72_RS24755 Protein ID WP_001034046.1
Coordinates 96270..96686 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag PIC72_RS24750 Protein ID WP_001261278.1
Coordinates 96043..96273 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC72_RS24720 (PIC72_24720) 91554..91859 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
PIC72_RS24725 (PIC72_24725) 91861..92079 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
PIC72_RS24730 (PIC72_24730) 92646..93158 + 513 WP_000151784.1 hypothetical protein -
PIC72_RS24735 (PIC72_24735) 93192..94325 - 1134 WP_001542067.1 DUF3800 domain-containing protein -
PIC72_RS24740 (PIC72_24740) 94492..95265 - 774 WP_000905949.1 hypothetical protein -
PIC72_RS24745 (PIC72_24745) 95278..95778 - 501 WP_001773886.1 HEPN family nuclease -
PIC72_RS24750 (PIC72_24750) 96043..96273 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PIC72_RS24755 (PIC72_24755) 96270..96686 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
PIC72_RS24760 (PIC72_24760) 96731..100525 - 3795 WP_001144732.1 hypothetical protein -
PIC72_RS24765 (PIC72_24765) 100906..101136 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
PIC72_RS24770 (PIC72_24770) 101133..101549 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(A) / blaTEM-1B / tet(B) / dfrA17 / sul2 / aph(3'')-Ib / aph(6)-Id senB 1..108072 108072


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T268384 WP_001034046.1 NZ_CP116192:96270-96686 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT268384 WP_001261278.1 NZ_CP116192:96043-96273 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References