Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3762394..3763048 | Replicon | chromosome |
Accession | NZ_CP116191 | ||
Organism | Escherichia coli strain DETEC-E1070 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | PIC72_RS18330 | Protein ID | WP_000244781.1 |
Coordinates | 3762394..3762801 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PIC72_RS18335 | Protein ID | WP_000354046.1 |
Coordinates | 3762782..3763048 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC72_RS18310 (3758351) | 3758351..3760084 | - | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PIC72_RS18315 (3760090) | 3760090..3760800 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PIC72_RS18320 (3760825) | 3760825..3761721 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PIC72_RS18325 (3761833) | 3761833..3762354 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
PIC72_RS18330 (3762394) | 3762394..3762801 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
PIC72_RS18335 (3762782) | 3762782..3763048 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PIC72_RS18340 (3763291) | 3763291..3764271 | + | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
PIC72_RS18345 (3764348) | 3764348..3765007 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
PIC72_RS18350 (3765171) | 3765171..3765482 | - | 312 | WP_001182959.1 | N(4)-acetylcytidine aminohydrolase | - |
PIC72_RS18355 (3765527) | 3765527..3766960 | + | 1434 | WP_001339296.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T268378 WP_000244781.1 NZ_CP116191:c3762801-3762394 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|