Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1203082..1203700 | Replicon | chromosome |
Accession | NZ_CP116191 | ||
Organism | Escherichia coli strain DETEC-E1070 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PIC72_RS05780 | Protein ID | WP_001291435.1 |
Coordinates | 1203082..1203300 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PIC72_RS05785 | Protein ID | WP_000344800.1 |
Coordinates | 1203326..1203700 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC72_RS05745 (1198377) | 1198377..1198949 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
PIC72_RS05750 (1198980) | 1198980..1199284 | - | 305 | Protein_1121 | MGMT family protein | - |
PIC72_RS05760 (1199663) | 1199663..1200016 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
PIC72_RS05765 (1200058) | 1200058..1201608 | - | 1551 | WP_001538392.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PIC72_RS05770 (1201772) | 1201772..1202242 | - | 471 | WP_000136192.1 | YlaC family protein | - |
PIC72_RS05775 (1202358) | 1202358..1202909 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
PIC72_RS05780 (1203082) | 1203082..1203300 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PIC72_RS05785 (1203326) | 1203326..1203700 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PIC72_RS05790 (1204246) | 1204246..1207395 | - | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
PIC72_RS05795 (1207418) | 1207418..1208611 | - | 1194 | WP_001538394.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T268369 WP_001291435.1 NZ_CP116191:c1203300-1203082 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT268369 WP_000344800.1 NZ_CP116191:c1203700-1203326 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |