Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 728460..729010 Replicon chromosome
Accession NZ_CP116191
Organism Escherichia coli strain DETEC-E1070

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag PIC72_RS03530 Protein ID WP_001160966.1
Coordinates 728696..729010 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag PIC72_RS03525 Protein ID WP_000125568.1
Coordinates 728460..728693 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC72_RS03500 (723533) 723533..723820 + 288 WP_000203741.1 ferredoxin-like protein FixX -
PIC72_RS03505 (723879) 723879..725210 + 1332 WP_001183207.1 MFS transporter -
PIC72_RS03510 (725318) 725318..725848 + 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
PIC72_RS03515 (725841) 725841..727703 + 1863 WP_000377109.1 glutathione-regulated potassium-efflux system protein KefC -
PIC72_RS03520 (727895) 727895..728374 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
PIC72_RS03525 (728460) 728460..728693 + 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PIC72_RS03530 (728696) 728696..729010 + 315 WP_001160966.1 CcdB family protein Toxin
PIC72_RS03535 (729007) 729007..729855 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
PIC72_RS03540 (729862) 729862..730239 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
PIC72_RS03545 (730242) 730242..731063 - 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
PIC72_RS03550 (731060) 731060..732049 - 990 WP_000241225.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
PIC72_RS03555 (732049) 732049..733335 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T268367 WP_001160966.1 NZ_CP116191:728696-729010 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT268367 WP_000125568.1 NZ_CP116191:728460-728693 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References