Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 315416..316248 | Replicon | chromosome |
| Accession | NZ_CP116191 | ||
| Organism | Escherichia coli strain DETEC-E1070 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | PIC72_RS01430 | Protein ID | WP_000854753.1 |
| Coordinates | 315416..315790 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | PIC72_RS01435 | Protein ID | WP_001540478.1 |
| Coordinates | 315880..316248 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC72_RS01410 (311769) | 311769..313307 | - | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
| PIC72_RS01415 (314056) | 314056..314625 | - | 570 | WP_001560692.1 | DUF4942 domain-containing protein | - |
| PIC72_RS01420 (314722) | 314722..314919 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| PIC72_RS01425 (314931) | 314931..315419 | - | 489 | WP_000777545.1 | DUF5983 family protein | - |
| PIC72_RS01430 (315416) | 315416..315790 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| PIC72_RS01435 (315880) | 315880..316248 | - | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PIC72_RS01440 (316411) | 316411..316632 | - | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| PIC72_RS01445 (316695) | 316695..317171 | - | 477 | WP_001186786.1 | RadC family protein | - |
| PIC72_RS01450 (317187) | 317187..317672 | - | 486 | WP_000214398.1 | antirestriction protein | - |
| PIC72_RS01455 (317763) | 317763..318581 | - | 819 | WP_001773857.1 | DUF932 domain-containing protein | - |
| PIC72_RS01460 (318671) | 318671..318904 | - | 234 | WP_001278283.1 | DUF905 family protein | - |
| PIC72_RS01465 (318910) | 318910..319587 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| PIC72_RS01470 (319735) | 319735..320415 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 303956..361731 | 57775 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T268360 WP_000854753.1 NZ_CP116191:c315790-315416 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT268360 WP_001540478.1 NZ_CP116191:c316248-315880 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NQ68 |