Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3991497..3992295 Replicon chromosome
Accession NZ_CP116188
Organism Escherichia coli strain DETEC-E223

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag PIC88_RS19495 Protein ID WP_000854735.1
Coordinates 3991918..3992295 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A067H947
Locus tag PIC88_RS19490 Protein ID WP_001285415.1
Coordinates 3991497..3991871 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC88_RS19455 (3987428) 3987428..3988108 + 681 WP_001282919.1 WYL domain-containing protein -
PIC88_RS19460 (3988256) 3988256..3988933 + 678 WP_001097302.1 hypothetical protein -
PIC88_RS19465 (3988939) 3988939..3989172 + 234 WP_001278287.1 DUF905 family protein -
PIC88_RS19470 (3989262) 3989262..3990080 + 819 WP_001175148.1 DUF932 domain-containing protein -
PIC88_RS19475 (3990162) 3990162..3990641 + 480 WP_000844100.1 antirestriction protein -
PIC88_RS19480 (3990657) 3990657..3991133 + 477 WP_001366855.1 RadC family protein -
PIC88_RS19485 (3991196) 3991196..3991417 + 222 WP_000692309.1 DUF987 domain-containing protein -
PIC88_RS19490 (3991497) 3991497..3991871 + 375 WP_001285415.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PIC88_RS19495 (3991918) 3991918..3992295 + 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
PIC88_RS19500 (3992292) 3992292..3992780 + 489 WP_000761676.1 DUF5983 family protein -
PIC88_RS19505 (3992792) 3992792..3992989 + 198 WP_000839291.1 DUF957 domain-containing protein -
PIC88_RS19510 (3993074) 3993074..3993940 + 867 WP_001280433.1 DUF4942 domain-containing protein -
PIC88_RS19515 (3994012) 3994012..3994275 + 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
PIC88_RS19520 (3994272) 3994272..3994598 + 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
PIC88_RS19525 (3995062) 3995062..3996324 + 1263 WP_033554035.1 integrase arm-type DNA-binding domain-containing protein -
PIC88_RS19530 (3996510) 3996510..3997199 - 690 Protein_3821 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3952534..4004392 51858


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T268347 WP_000854735.1 NZ_CP116188:3991918-3992295 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13663.32 Da        Isoelectric Point: 5.8640

>AT268347 WP_001285415.1 NZ_CP116188:3991497-3991871 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A067H947

References