Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3846937..3847591 | Replicon | chromosome |
| Accession | NZ_CP116188 | ||
| Organism | Escherichia coli strain DETEC-E223 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | PIC88_RS18760 | Protein ID | WP_000244781.1 |
| Coordinates | 3846937..3847344 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PIC88_RS18765 | Protein ID | WP_000354046.1 |
| Coordinates | 3847325..3847591 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC88_RS18740 (3842894) | 3842894..3844627 | - | 1734 | WP_000813198.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PIC88_RS18745 (3844633) | 3844633..3845343 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PIC88_RS18750 (3845368) | 3845368..3846264 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PIC88_RS18755 (3846376) | 3846376..3846897 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| PIC88_RS18760 (3846937) | 3846937..3847344 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| PIC88_RS18765 (3847325) | 3847325..3847591 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PIC88_RS18770 (3847834) | 3847834..3848814 | + | 981 | WP_000886083.1 | tRNA-modifying protein YgfZ | - |
| PIC88_RS18775 (3849010) | 3849010..3849669 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| PIC88_RS18780 (3849833) | 3849833..3850144 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| PIC88_RS18785 (3850189) | 3850189..3851622 | + | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
| PIC88_RS18790 (3851679) | 3851679..3852422 | - | 744 | WP_061359834.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T268346 WP_000244781.1 NZ_CP116188:c3847344-3846937 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|