Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3751638..3752221 | Replicon | chromosome |
Accession | NZ_CP116188 | ||
Organism | Escherichia coli strain DETEC-E223 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | PIC88_RS18330 | Protein ID | WP_000254738.1 |
Coordinates | 3751638..3751973 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | PIC88_RS18335 | Protein ID | WP_000581937.1 |
Coordinates | 3751973..3752221 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC88_RS18315 (3747525) | 3747525..3748823 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
PIC88_RS18320 (3748911) | 3748911..3750548 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
PIC88_RS18325 (3750776) | 3750776..3751567 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
PIC88_RS18330 (3751638) | 3751638..3751973 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
PIC88_RS18335 (3751973) | 3751973..3752221 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PIC88_RS18340 (3752299) | 3752299..3754533 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
PIC88_RS18345 (3754581) | 3754581..3755882 | - | 1302 | WP_048217978.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T268345 WP_000254738.1 NZ_CP116188:c3751973-3751638 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|