Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2956034..2956865 Replicon chromosome
Accession NZ_CP116188
Organism Escherichia coli strain DETEC-E223

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag PIC88_RS14650 Protein ID WP_000854814.1
Coordinates 2956491..2956865 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag PIC88_RS14645 Protein ID WP_001285585.1
Coordinates 2956034..2956402 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC88_RS14610 (2951266) 2951266..2952336 + 1071 WP_000102644.1 patatin-like phospholipase family protein -
PIC88_RS14615 (2952472) 2952472..2953155 + 684 WP_000775500.1 hypothetical protein -
PIC88_RS14620 (2953171) 2953171..2953581 + 411 WP_000846713.1 hypothetical protein -
PIC88_RS14625 (2953802) 2953802..2954623 + 822 WP_048217813.1 DUF932 domain-containing protein -
PIC88_RS14630 (2954705) 2954705..2955184 + 480 WP_000860081.1 antirestriction protein -
PIC88_RS14635 (2955200) 2955200..2955676 + 477 WP_001186773.1 RadC family protein -
PIC88_RS14640 (2955739) 2955739..2955960 + 222 WP_000692323.1 DUF987 domain-containing protein -
PIC88_RS14645 (2956034) 2956034..2956402 + 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PIC88_RS14650 (2956491) 2956491..2956865 + 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
PIC88_RS14655 (2956862) 2956862..2957056 + 195 WP_000988600.1 DUF5983 family protein -
PIC88_RS14660 (2957102) 2957102..2957182 + 81 Protein_2872 hypothetical protein -
PIC88_RS14665 (2957471) 2957471..2957599 - 129 Protein_2873 transposase domain-containing protein -
PIC88_RS14670 (2957719) 2957719..2957853 + 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
PIC88_RS14675 (2957954) 2957954..2958283 - 330 WP_000450409.1 DUF496 family protein -
PIC88_RS14680 (2958455) 2958455..2959513 - 1059 WP_001200890.1 FUSC family protein -
PIC88_RS14685 (2959711) 2959711..2960184 - 474 WP_001105416.1 DNA gyrase inhibitor SbmC -
PIC88_RS14690 (2960303) 2960303..2961469 - 1167 WP_000830144.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T268343 WP_000854814.1 NZ_CP116188:2956491-2956865 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT268343 WP_001285585.1 NZ_CP116188:2956034-2956402 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References