Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2279142..2279780 | Replicon | chromosome |
| Accession | NZ_CP116188 | ||
| Organism | Escherichia coli strain DETEC-E223 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
| Locus tag | PIC88_RS11265 | Protein ID | WP_001447010.1 |
| Coordinates | 2279142..2279318 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PIC88_RS11270 | Protein ID | WP_001270286.1 |
| Coordinates | 2279364..2279780 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC88_RS11245 (2274761) | 2274761..2275936 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
| PIC88_RS11250 (2276028) | 2276028..2276564 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| PIC88_RS11255 (2276637) | 2276637..2278598 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| PIC88_RS11260 (2278690) | 2278690..2278920 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| PIC88_RS11265 (2279142) | 2279142..2279318 | + | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| PIC88_RS11270 (2279364) | 2279364..2279780 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| PIC88_RS11275 (2279859) | 2279859..2281265 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| PIC88_RS11280 (2281510) | 2281510..2282655 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| PIC88_RS11285 (2282673) | 2282673..2283686 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| PIC88_RS11290 (2283687) | 2283687..2284628 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T268337 WP_001447010.1 NZ_CP116188:2279142-2279318 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT268337 WP_001270286.1 NZ_CP116188:2279364-2279780 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|