Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1159377..1159995 | Replicon | chromosome |
Accession | NZ_CP116188 | ||
Organism | Escherichia coli strain DETEC-E223 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PIC88_RS05615 | Protein ID | WP_001291435.1 |
Coordinates | 1159377..1159595 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PIC88_RS05620 | Protein ID | WP_000344800.1 |
Coordinates | 1159621..1159995 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC88_RS05580 (1154666) | 1154666..1155238 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
PIC88_RS05585 (1155269) | 1155269..1155580 | - | 312 | WP_000409911.1 | MGMT family protein | - |
PIC88_RS05595 (1155959) | 1155959..1156312 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
PIC88_RS05600 (1156354) | 1156354..1157904 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PIC88_RS05605 (1158068) | 1158068..1158538 | - | 471 | WP_000136192.1 | YlaC family protein | - |
PIC88_RS05610 (1158654) | 1158654..1159205 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
PIC88_RS05615 (1159377) | 1159377..1159595 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PIC88_RS05620 (1159621) | 1159621..1159995 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PIC88_RS05625 (1160541) | 1160541..1163690 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PIC88_RS05630 (1163713) | 1163713..1164906 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T268336 WP_001291435.1 NZ_CP116188:c1159595-1159377 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT268336 WP_000344800.1 NZ_CP116188:c1159995-1159621 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |