Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 4971..5518 Replicon plasmid pDETEC57
Accession NZ_CP116184
Organism Escherichia coli strain DETEC-E480

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag PIB86_RS25640 Protein ID WP_244449344.1
Coordinates 5240..5518 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E2GHF7
Locus tag PIB86_RS25635 Protein ID WP_012881119.1
Coordinates 4971..5240 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB86_RS25605 (PIB86_25605) 137..562 + 426 WP_000422741.1 transposase -
PIB86_RS25610 (PIB86_25610) 559..909 + 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
PIB86_RS25615 (PIB86_25615) 940..2553 + 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
PIB86_RS25620 (PIB86_25620) 2641..2895 + 255 WP_000083830.1 replication regulatory protein RepA -
PIB86_RS25625 (PIB86_25625) 3133..3207 + 75 WP_001365705.1 RepA leader peptide Tap -
PIB86_RS25630 (PIB86_25630) 3200..4057 + 858 WP_000130646.1 incFII family plasmid replication initiator RepA -
PIB86_RS25635 (PIB86_25635) 4971..5240 + 270 WP_012881119.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
PIB86_RS25640 (PIB86_25640) 5240..5518 + 279 WP_244449344.1 type II toxin-antitoxin system toxin YacB Toxin
PIB86_RS25645 (PIB86_25645) 5564..6412 + 849 WP_012881117.1 3'-5' exonuclease -
PIB86_RS25650 (PIB86_25650) 6529..7011 + 483 WP_001311056.1 hypothetical protein -
PIB86_RS25655 (PIB86_25655) 7046..8068 - 1023 Protein_10 maltoporin LamB -
PIB86_RS25660 (PIB86_25660) 8117..8524 - 408 Protein_11 IS5-like element IS903B family transposase -
PIB86_RS25665 (PIB86_25665) 8604..9479 - 876 WP_001617865.1 extended-spectrum class A beta-lactamase CTX-M-14 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-14 - 1..13744 13744
- flank IS/Tn blaCTX-M-14 - 8604..11169 2565


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10744.34 Da        Isoelectric Point: 8.4615

>T268332 WP_244449344.1 NZ_CP116184:5240-5518 [Escherichia coli]
MEIFWTILASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10206.54 Da        Isoelectric Point: 8.8735

>AT268332 WP_012881119.1 NZ_CP116184:4971-5240 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLERGDVLPHDMVESSATAWRD
EISRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4Y1YSD8

References