Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 7747..8390 | Replicon | plasmid pDETEC56 |
Accession | NZ_CP116183 | ||
Organism | Escherichia coli strain DETEC-E480 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | PIB86_RS25025 | Protein ID | WP_001044768.1 |
Coordinates | 7974..8390 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | PIB86_RS25020 | Protein ID | WP_001261287.1 |
Coordinates | 7747..7977 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB86_RS24995 (3074) | 3074..4273 | - | 1200 | WP_000948429.1 | IS91 family transposase | - |
PIB86_RS25000 (4283) | 4283..4471 | - | 189 | WP_000957857.1 | hypothetical protein | - |
PIB86_RS25005 (4600) | 4600..6222 | + | 1623 | WP_271287831.1 | P-loop NTPase fold protein | - |
PIB86_RS25010 (6272) | 6272..7171 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
PIB86_RS25015 (7161) | 7161..7451 | - | 291 | WP_000111771.1 | hypothetical protein | - |
PIB86_RS25020 (7747) | 7747..7977 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PIB86_RS25025 (7974) | 7974..8390 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PIB86_RS25030 (8552) | 8552..10690 | - | 2139 | WP_000350638.1 | AAA family ATPase | - |
PIB86_RS25035 (11044) | 11044..11301 | + | 258 | WP_000343085.1 | hypothetical protein | - |
PIB86_RS25040 (11301) | 11301..11891 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | fosA3 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / rmtB / blaTEM-1B / blaCTX-M-55 | - | 1..103383 | 103383 | |
- | flank | IS/Tn | - | - | 3074..4273 | 1199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T268329 WP_001044768.1 NZ_CP116183:7974-8390 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |