Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 99040..99641 | Replicon | plasmid pDETEC55 |
Accession | NZ_CP116182 | ||
Organism | Escherichia coli strain DETEC-E480 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | PIB86_RS24915 | Protein ID | WP_001216034.1 |
Coordinates | 99261..99641 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | PIB86_RS24910 | Protein ID | WP_001190712.1 |
Coordinates | 99040..99261 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB86_RS24900 (96021) | 96021..97304 | - | 1284 | WP_001617890.1 | restriction endonuclease subunit S | - |
PIB86_RS24905 (97301) | 97301..98857 | - | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
PIB86_RS24910 (99040) | 99040..99261 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PIB86_RS24915 (99261) | 99261..99641 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PIB86_RS24920 (99646) | 99646..99825 | + | 180 | WP_001513661.1 | hypothetical protein | - |
PIB86_RS24925 (99853) | 99853..100131 | + | 279 | Protein_124 | pdcB | - |
PIB86_RS24930 (100136) | 100136..100549 | + | 414 | Protein_125 | integrase core domain-containing protein | - |
PIB86_RS24935 (100499) | 100499..100834 | - | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
PIB86_RS24940 (101044) | 101044..102024 | - | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
PIB86_RS24945 (102268) | 102268..103671 | + | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
PIB86_RS24950 (103658) | 103658..104590 | + | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | sul1 / aadA5 / mph(A) / blaTEM-1B / aac(3)-IId | senB | 1..107932 | 107932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T268328 WP_001216034.1 NZ_CP116182:99261-99641 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |