Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4244522..4245357 | Replicon | chromosome |
| Accession | NZ_CP116181 | ||
| Organism | Escherichia coli strain DETEC-E480 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | PIB86_RS20850 | Protein ID | WP_000854759.1 |
| Coordinates | 4244522..4244899 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | PIB86_RS20855 | Protein ID | WP_001295723.1 |
| Coordinates | 4244989..4245357 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB86_RS20825 (4240633) | 4240633..4242255 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| PIB86_RS20830 (4243046) | 4243046..4243222 | - | 177 | Protein_4088 | helix-turn-helix domain-containing protein | - |
| PIB86_RS20835 (4243589) | 4243589..4243738 | - | 150 | Protein_4089 | hypothetical protein | - |
| PIB86_RS20840 (4243844) | 4243844..4244020 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| PIB86_RS20845 (4244037) | 4244037..4244525 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| PIB86_RS20850 (4244522) | 4244522..4244899 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| PIB86_RS20855 (4244989) | 4244989..4245357 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PIB86_RS20860 (4245520) | 4245520..4245741 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| PIB86_RS20865 (4245804) | 4245804..4246280 | - | 477 | WP_001186775.1 | RadC family protein | - |
| PIB86_RS20870 (4246296) | 4246296..4246769 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| PIB86_RS20875 (4247111) | 4247111..4247848 | - | 738 | Protein_4097 | DUF932 domain-containing protein | - |
| PIB86_RS20880 (4247933) | 4247933..4248679 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| PIB86_RS20885 (4248694) | 4248694..4250235 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T268320 WP_000854759.1 NZ_CP116181:c4244899-4244522 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT268320 WP_001295723.1 NZ_CP116181:c4245357-4244989 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |