Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4051700..4052220 Replicon chromosome
Accession NZ_CP116181
Organism Escherichia coli strain DETEC-E480

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag PIB86_RS19910 Protein ID WP_001160964.1
Coordinates 4051700..4051984 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag PIB86_RS19915 Protein ID WP_000125566.1
Coordinates 4051987..4052220 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB86_RS19885 (4047345) 4047345..4048631 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
PIB86_RS19890 (4048631) 4048631..4049620 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
PIB86_RS19895 (4049617) 4049617..4050438 + 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
PIB86_RS19900 (4050441) 4050441..4050818 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
PIB86_RS19905 (4050825) 4050825..4051673 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
PIB86_RS19910 (4051700) 4051700..4051984 - 285 WP_001160964.1 CcdB family protein Toxin
PIB86_RS19915 (4051987) 4051987..4052220 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PIB86_RS19920 (4052306) 4052306..4052785 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
PIB86_RS19925 (4052977) 4052977..4054839 - 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
PIB86_RS19930 (4054832) 4054832..4055362 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
PIB86_RS19935 (4055470) 4055470..4056801 - 1332 WP_001183209.1 MFS transporter -
PIB86_RS19940 (4056860) 4056860..4057147 - 288 WP_000203744.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T268318 WP_001160964.1 NZ_CP116181:c4051984-4051700 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT268318 WP_000125566.1 NZ_CP116181:c4052220-4051987 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References