Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3600011..3600629 | Replicon | chromosome |
| Accession | NZ_CP116181 | ||
| Organism | Escherichia coli strain DETEC-E480 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | PIB86_RS17755 | Protein ID | WP_001291435.1 |
| Coordinates | 3600411..3600629 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | PIB86_RS17750 | Protein ID | WP_000344800.1 |
| Coordinates | 3600011..3600385 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB86_RS17740 (3595100) | 3595100..3596293 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PIB86_RS17745 (3596316) | 3596316..3599465 | + | 3150 | WP_271287807.1 | efflux RND transporter permease AcrB | - |
| PIB86_RS17750 (3600011) | 3600011..3600385 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| PIB86_RS17755 (3600411) | 3600411..3600629 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| PIB86_RS17760 (3600803) | 3600803..3601354 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| PIB86_RS17765 (3601470) | 3601470..3601940 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| PIB86_RS17770 (3602104) | 3602104..3603654 | + | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| PIB86_RS17775 (3603696) | 3603696..3604049 | - | 354 | WP_000878135.1 | DUF1428 family protein | - |
| PIB86_RS17785 (3604428) | 3604428..3604739 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| PIB86_RS17790 (3604770) | 3604770..3605342 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T268316 WP_001291435.1 NZ_CP116181:3600411-3600629 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT268316 WP_000344800.1 NZ_CP116181:3600011-3600385 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |