Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 824076..824910 | Replicon | chromosome |
| Accession | NZ_CP116181 | ||
| Organism | Escherichia coli strain DETEC-E480 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | PIB86_RS04020 | Protein ID | WP_000854690.1 |
| Coordinates | 824076..824453 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | PIB86_RS04025 | Protein ID | WP_001305076.1 |
| Coordinates | 824542..824910 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB86_RS03990 (820470) | 820470..820640 | - | 171 | Protein_784 | IS110 family transposase | - |
| PIB86_RS03995 (821057) | 821057..821990 | - | 934 | Protein_785 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| PIB86_RS04000 (821983) | 821983..822378 | - | 396 | WP_000208384.1 | DUF6088 family protein | - |
| PIB86_RS04005 (822447) | 822447..823292 | - | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| PIB86_RS04010 (823377) | 823377..823574 | - | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| PIB86_RS04015 (823591) | 823591..824079 | - | 489 | WP_000761699.1 | DUF5983 family protein | - |
| PIB86_RS04020 (824076) | 824076..824453 | - | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| PIB86_RS04025 (824542) | 824542..824910 | - | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PIB86_RS04030 (824960) | 824960..825604 | - | 645 | WP_000094916.1 | hypothetical protein | - |
| PIB86_RS04035 (825623) | 825623..825844 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| PIB86_RS04040 (825907) | 825907..826383 | - | 477 | WP_001186726.1 | RadC family protein | - |
| PIB86_RS04045 (826399) | 826399..826884 | - | 486 | WP_000849565.1 | antirestriction protein | - |
| PIB86_RS04050 (826939) | 826939..827757 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| PIB86_RS04055 (827858) | 827858..828091 | - | 234 | WP_000902034.1 | DUF905 family protein | - |
| PIB86_RS04060 (828170) | 828170..828625 | - | 456 | WP_000581502.1 | IrmA family protein | - |
| PIB86_RS04065 (828701) | 828701..829828 | - | 1128 | Protein_799 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | ugd / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / sat | 804526..873122 | 68596 | |
| - | flank | IS/Tn | - | - | 820470..820625 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T268307 WP_000854690.1 NZ_CP116181:c824453-824076 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT268307 WP_001305076.1 NZ_CP116181:c824910-824542 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|