Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 824076..824910 Replicon chromosome
Accession NZ_CP116181
Organism Escherichia coli strain DETEC-E480

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag PIB86_RS04020 Protein ID WP_000854690.1
Coordinates 824076..824453 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag PIB86_RS04025 Protein ID WP_001305076.1
Coordinates 824542..824910 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB86_RS03990 (820470) 820470..820640 - 171 Protein_784 IS110 family transposase -
PIB86_RS03995 (821057) 821057..821990 - 934 Protein_785 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
PIB86_RS04000 (821983) 821983..822378 - 396 WP_000208384.1 DUF6088 family protein -
PIB86_RS04005 (822447) 822447..823292 - 846 WP_001529401.1 DUF4942 domain-containing protein -
PIB86_RS04010 (823377) 823377..823574 - 198 WP_000839293.1 DUF957 domain-containing protein -
PIB86_RS04015 (823591) 823591..824079 - 489 WP_000761699.1 DUF5983 family protein -
PIB86_RS04020 (824076) 824076..824453 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
PIB86_RS04025 (824542) 824542..824910 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PIB86_RS04030 (824960) 824960..825604 - 645 WP_000094916.1 hypothetical protein -
PIB86_RS04035 (825623) 825623..825844 - 222 WP_000692329.1 DUF987 domain-containing protein -
PIB86_RS04040 (825907) 825907..826383 - 477 WP_001186726.1 RadC family protein -
PIB86_RS04045 (826399) 826399..826884 - 486 WP_000849565.1 antirestriction protein -
PIB86_RS04050 (826939) 826939..827757 - 819 WP_001234620.1 DUF932 domain-containing protein -
PIB86_RS04055 (827858) 827858..828091 - 234 WP_000902034.1 DUF905 family protein -
PIB86_RS04060 (828170) 828170..828625 - 456 WP_000581502.1 IrmA family protein -
PIB86_RS04065 (828701) 828701..829828 - 1128 Protein_799 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - ugd / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / sat 804526..873122 68596
- flank IS/Tn - - 820470..820625 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T268307 WP_000854690.1 NZ_CP116181:c824453-824076 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT268307 WP_001305076.1 NZ_CP116181:c824910-824542 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References