Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 14542..15064 Replicon plasmid pDETEC62
Accession NZ_CP116178
Organism Escherichia coli strain DETEC-E601

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag PIC02_RS24435 Protein ID WP_000220560.1
Coordinates 14783..15064 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag PIC02_RS24430 Protein ID WP_000121743.1
Coordinates 14542..14793 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC02_RS24405 (PIC02_24395) 9640..10617 + 978 WP_072671515.1 hypothetical protein -
PIC02_RS24410 (PIC02_24400) 10614..10970 - 357 WP_001426297.1 DNA distortion polypeptide 3 -
PIC02_RS24415 (PIC02_24405) 11158..11601 - 444 WP_072671517.1 hypothetical protein -
PIC02_RS24420 (PIC02_24410) 11605..12447 - 843 WP_072671519.1 replication initiation protein -
PIC02_RS24425 (PIC02_24415) 12468..13307 - 840 WP_001352874.1 replication initiation protein -
PIC02_RS24430 (PIC02_24420) 14542..14793 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
PIC02_RS24435 (PIC02_24425) 14783..15064 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PIC02_RS24440 (PIC02_24430) 15210..15533 + 324 WP_001181903.1 hypothetical protein -
PIC02_RS24445 (PIC02_24435) 15578..15823 + 246 WP_000356546.1 hypothetical protein -
PIC02_RS24450 (PIC02_24440) 15813..16028 + 216 WP_001180117.1 hypothetical protein -
PIC02_RS24455 (PIC02_24445) 16121..16450 + 330 WP_000866654.1 hypothetical protein -
PIC02_RS24460 (PIC02_24450) 16493..16672 + 180 WP_000439079.1 hypothetical protein -
PIC02_RS24465 (PIC02_24455) 16742..16891 + 150 WP_167777664.1 hypothetical protein -
PIC02_RS24470 (PIC02_24460) 16904..17176 + 273 WP_000160399.1 hypothetical protein -
PIC02_RS24475 (PIC02_24465) 17510..18055 + 546 WP_001426313.1 DNA distortion polypeptide 1 -
PIC02_RS24480 (PIC02_24470) 18058..19224 + 1167 WP_072671520.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..36682 36682


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T268303 WP_000220560.1 NZ_CP116178:14783-15064 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT268303 WP_000121743.1 NZ_CP116178:14542-14793 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References