Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3800974..3801628 | Replicon | chromosome |
Accession | NZ_CP116176 | ||
Organism | Escherichia coli strain DETEC-E601 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | PIC02_RS18360 | Protein ID | WP_000244772.1 |
Coordinates | 3800974..3801381 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PIC02_RS18365 | Protein ID | WP_000354046.1 |
Coordinates | 3801362..3801628 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC02_RS18340 (3796931) | 3796931..3798664 | - | 1734 | WP_000813211.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PIC02_RS18345 (3798670) | 3798670..3799380 | - | 711 | WP_000715212.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PIC02_RS18350 (3799405) | 3799405..3800301 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PIC02_RS18355 (3800413) | 3800413..3800934 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
PIC02_RS18360 (3800974) | 3800974..3801381 | - | 408 | WP_000244772.1 | protein YgfX | Toxin |
PIC02_RS18365 (3801362) | 3801362..3801628 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PIC02_RS18370 (3801871) | 3801871..3802851 | + | 981 | WP_000886064.1 | tRNA-modifying protein YgfZ | - |
PIC02_RS18375 (3802928) | 3802928..3803587 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
PIC02_RS18380 (3803751) | 3803751..3804062 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
PIC02_RS18385 (3804107) | 3804107..3805540 | + | 1434 | WP_001344773.1 | 6-phospho-beta-glucosidase BglA | - |
PIC02_RS18390 (3805597) | 3805597..3806340 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T268296 WP_000244772.1 NZ_CP116176:c3801381-3800974 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |