Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3664704..3665287 | Replicon | chromosome |
Accession | NZ_CP116176 | ||
Organism | Escherichia coli strain DETEC-E601 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | F4NJF2 |
Locus tag | PIC02_RS17745 | Protein ID | WP_000254731.1 |
Coordinates | 3664704..3665039 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | PIC02_RS17750 | Protein ID | WP_000581937.1 |
Coordinates | 3665039..3665287 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC02_RS17730 (3660591) | 3660591..3661889 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
PIC02_RS17735 (3661977) | 3661977..3663614 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
PIC02_RS17740 (3663842) | 3663842..3664633 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
PIC02_RS17745 (3664704) | 3664704..3665039 | - | 336 | WP_000254731.1 | endoribonuclease MazF | Toxin |
PIC02_RS17750 (3665039) | 3665039..3665287 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PIC02_RS17755 (3665365) | 3665365..3667599 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
PIC02_RS17760 (3667647) | 3667647..3668948 | - | 1302 | WP_000046789.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12043.02 Da Isoelectric Point: 8.1170
>T268295 WP_000254731.1 NZ_CP116176:c3665039-3664704 [Escherichia coli]
MVSRYVPDMGDLICVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVVPEELQLIKAKINVLIG
MVSRYVPDMGDLICVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVVPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|