Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3357603..3358228 | Replicon | chromosome |
Accession | NZ_CP116176 | ||
Organism | Escherichia coli strain DETEC-E601 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | PIC02_RS16230 | Protein ID | WP_000911329.1 |
Coordinates | 3357603..3358001 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | PIC02_RS16235 | Protein ID | WP_000450524.1 |
Coordinates | 3358001..3358228 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC02_RS16210 (3353510) | 3353510..3353710 | + | 201 | WP_000383836.1 | YpfN family protein | - |
PIC02_RS16215 (3353791) | 3353791..3354489 | - | 699 | WP_000679812.1 | esterase | - |
PIC02_RS16220 (3354563) | 3354563..3356578 | - | 2016 | WP_236930000.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
PIC02_RS16225 (3356593) | 3356593..3357456 | - | 864 | WP_001267495.1 | neutral zinc metallopeptidase | - |
PIC02_RS16230 (3357603) | 3357603..3358001 | - | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PIC02_RS16235 (3358001) | 3358001..3358228 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PIC02_RS16240 (3358383) | 3358383..3359096 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PIC02_RS16245 (3359309) | 3359309..3360343 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
PIC02_RS16250 (3360360) | 3360360..3361238 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
PIC02_RS16255 (3361384) | 3361384..3361956 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
PIC02_RS16260 (3361956) | 3361956..3362426 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T268294 WP_000911329.1 NZ_CP116176:c3358001-3357603 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |