Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1181311..1181929 | Replicon | chromosome |
Accession | NZ_CP116176 | ||
Organism | Escherichia coli strain DETEC-E601 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PIC02_RS05605 | Protein ID | WP_001291435.1 |
Coordinates | 1181311..1181529 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PIC02_RS05610 | Protein ID | WP_000344800.1 |
Coordinates | 1181555..1181929 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC02_RS05570 (1176601) | 1176601..1177173 | + | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
PIC02_RS05575 (1177204) | 1177204..1177515 | - | 312 | WP_000409911.1 | MGMT family protein | - |
PIC02_RS05585 (1177894) | 1177894..1178247 | + | 354 | WP_000878141.1 | DUF1428 family protein | - |
PIC02_RS05590 (1178289) | 1178289..1179839 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PIC02_RS05595 (1180003) | 1180003..1180473 | - | 471 | WP_000136192.1 | YlaC family protein | - |
PIC02_RS05600 (1180589) | 1180589..1181140 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
PIC02_RS05605 (1181311) | 1181311..1181529 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PIC02_RS05610 (1181555) | 1181555..1181929 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PIC02_RS05615 (1182475) | 1182475..1185624 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PIC02_RS05620 (1185647) | 1185647..1186840 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T268287 WP_001291435.1 NZ_CP116176:c1181529-1181311 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT268287 WP_000344800.1 NZ_CP116176:c1181929-1181555 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |