Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1147016..1147853 | Replicon | chromosome |
Accession | NZ_CP116176 | ||
Organism | Escherichia coli strain DETEC-E601 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | PIC02_RS05435 | Protein ID | WP_000227784.1 |
Coordinates | 1147016..1147558 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | PIC02_RS05440 | Protein ID | WP_001297137.1 |
Coordinates | 1147542..1147853 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC02_RS05415 (1142555) | 1142555..1143466 | - | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
PIC02_RS05420 (1143634) | 1143634..1144125 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
PIC02_RS05425 (1144253) | 1144253..1145617 | - | 1365 | WP_001000960.1 | MFS transporter | - |
PIC02_RS05430 (1146025) | 1146025..1146960 | + | 936 | Protein_1057 | tetratricopeptide repeat protein | - |
PIC02_RS05435 (1147016) | 1147016..1147558 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
PIC02_RS05440 (1147542) | 1147542..1147853 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
PIC02_RS05445 (1148038) | 1148038..1148928 | - | 891 | WP_000971336.1 | heme o synthase | - |
PIC02_RS05450 (1148940) | 1148940..1149269 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
PIC02_RS05455 (1149269) | 1149269..1149883 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
PIC02_RS05460 (1149873) | 1149873..1151864 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
PIC02_RS05465 (1151886) | 1151886..1152833 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T268286 WP_000227784.1 NZ_CP116176:c1147558-1147016 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|