Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4185921..4186722 Replicon chromosome
Accession NZ_CP116169
Organism Escherichia coli strain DETEC-P1056

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag PIC86_RS20255 Protein ID WP_097413076.1
Coordinates 4185921..4186298 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag PIC86_RS20260 Protein ID WP_097413080.1
Coordinates 4186345..4186722 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC86_RS20215 (4181143) 4181143..4181457 - 315 WP_001296681.1 primosomal replication protein N -
PIC86_RS20220 (4181464) 4181464..4181859 - 396 WP_001216676.1 30S ribosomal protein S6 -
PIC86_RS20225 (4182186) 4182186..4182461 + 276 WP_000492911.1 DUF1471 family protein YjfY -
PIC86_RS20230 (4182590) 4182590..4183276 - 687 WP_001170846.1 L-ribulose-5-phosphate 4-epimerase UlaF -
PIC86_RS20235 (4183276) 4183276..4184100 - 825 WP_152065769.1 L-ribulose-5-phosphate 3-epimerase UlaE -
PIC86_RS20240 (4184294) 4184294..4185142 - 849 WP_196613069.1 DUF4942 domain-containing protein -
PIC86_RS20245 (4185227) 4185227..4185424 - 198 WP_000839267.1 DUF957 domain-containing protein -
PIC86_RS20250 (4185436) 4185436..4185924 - 489 WP_097417833.1 DUF5983 family protein -
PIC86_RS20255 (4185921) 4185921..4186298 - 378 WP_097413076.1 TA system toxin CbtA family protein Toxin
PIC86_RS20260 (4186345) 4186345..4186722 - 378 WP_097413080.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PIC86_RS20265 (4186797) 4186797..4187018 - 222 WP_000692306.1 DUF987 domain-containing protein -
PIC86_RS20270 (4187087) 4187087..4187563 - 477 WP_001186771.1 RadC family protein -
PIC86_RS20275 (4187579) 4187579..4188052 - 474 WP_180193221.1 antirestriction protein -
PIC86_RS20280 (4188238) 4188238..4188390 - 153 WP_176079112.1 hypothetical protein -
PIC86_RS20285 (4188390) 4188390..4189211 - 822 WP_196613068.1 DUF932 domain-containing protein -
PIC86_RS20290 (4189232) 4189232..4189603 - 372 WP_252505442.1 DUF905 family protein -
PIC86_RS20295 (4189621) 4189621..4190076 - 456 WP_160445732.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13976.84 Da        Isoelectric Point: 7.3225

>T268276 WP_097413076.1 NZ_CP116169:c4186298-4185921 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRSHYRTVNDITQGKRTEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13698.56 Da        Isoelectric Point: 5.9505

>AT268276 WP_097413080.1 NZ_CP116169:c4186722-4186345 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References