Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3494553..3495390 | Replicon | chromosome |
| Accession | NZ_CP116169 | ||
| Organism | Escherichia coli strain DETEC-P1056 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | PIC86_RS17035 | Protein ID | WP_000227784.1 |
| Coordinates | 3494848..3495390 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | PIC86_RS17030 | Protein ID | WP_001297137.1 |
| Coordinates | 3494553..3494864 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC86_RS17005 (3489573) | 3489573..3490520 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| PIC86_RS17010 (3490542) | 3490542..3492533 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| PIC86_RS17015 (3492523) | 3492523..3493137 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| PIC86_RS17020 (3493137) | 3493137..3493466 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| PIC86_RS17025 (3493478) | 3493478..3494368 | + | 891 | WP_000971336.1 | heme o synthase | - |
| PIC86_RS17030 (3494553) | 3494553..3494864 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| PIC86_RS17035 (3494848) | 3494848..3495390 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| PIC86_RS17040 (3495446) | 3495446..3496381 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
| PIC86_RS17045 (3496789) | 3496789..3498153 | + | 1365 | WP_001000978.1 | MFS transporter | - |
| PIC86_RS17050 (3498281) | 3498281..3498772 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| PIC86_RS17055 (3498940) | 3498940..3499851 | + | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T268273 WP_000227784.1 NZ_CP116169:3494848-3495390 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|