Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3460476..3461094 | Replicon | chromosome |
Accession | NZ_CP116169 | ||
Organism | Escherichia coli strain DETEC-P1056 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PIC86_RS16865 | Protein ID | WP_001291435.1 |
Coordinates | 3460876..3461094 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PIC86_RS16860 | Protein ID | WP_000344800.1 |
Coordinates | 3460476..3460850 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC86_RS16850 (3455565) | 3455565..3456758 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PIC86_RS16855 (3456781) | 3456781..3459930 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PIC86_RS16860 (3460476) | 3460476..3460850 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PIC86_RS16865 (3460876) | 3460876..3461094 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PIC86_RS16870 (3461266) | 3461266..3461817 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
PIC86_RS16875 (3461933) | 3461933..3462403 | + | 471 | WP_000136192.1 | YlaC family protein | - |
PIC86_RS16880 (3462567) | 3462567..3464117 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PIC86_RS16885 (3464159) | 3464159..3464512 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
PIC86_RS16895 (3464891) | 3464891..3465202 | + | 312 | WP_000409911.1 | MGMT family protein | - |
PIC86_RS16900 (3465233) | 3465233..3465805 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T268272 WP_001291435.1 NZ_CP116169:3460876-3461094 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT268272 WP_000344800.1 NZ_CP116169:3460476-3460850 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |