Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2456353..2456991 | Replicon | chromosome |
| Accession | NZ_CP116169 | ||
| Organism | Escherichia coli strain DETEC-P1056 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | PIC86_RS11985 | Protein ID | WP_000813794.1 |
| Coordinates | 2456815..2456991 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PIC86_RS11980 | Protein ID | WP_001270286.1 |
| Coordinates | 2456353..2456769 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC86_RS11960 (2451505) | 2451505..2452446 | - | 942 | WP_001251319.1 | ABC transporter permease | - |
| PIC86_RS11965 (2452447) | 2452447..2453460 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| PIC86_RS11970 (2453478) | 2453478..2454623 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| PIC86_RS11975 (2454868) | 2454868..2456274 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| PIC86_RS11980 (2456353) | 2456353..2456769 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| PIC86_RS11985 (2456815) | 2456815..2456991 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| PIC86_RS11990 (2457213) | 2457213..2457443 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| PIC86_RS11995 (2457535) | 2457535..2459496 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| PIC86_RS12000 (2459569) | 2459569..2460105 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
| PIC86_RS12005 (2460197) | 2460197..2461372 | + | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2461412..2462677 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T268270 WP_000813794.1 NZ_CP116169:c2456991-2456815 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT268270 WP_001270286.1 NZ_CP116169:c2456769-2456353 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|