Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1341047..1341672 | Replicon | chromosome |
| Accession | NZ_CP116169 | ||
| Organism | Escherichia coli strain DETEC-P1056 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PIC86_RS06565 | Protein ID | WP_000911330.1 |
| Coordinates | 1341274..1341672 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | PIC86_RS06560 | Protein ID | WP_000450524.1 |
| Coordinates | 1341047..1341274 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC86_RS06535 (1336850) | 1336850..1337320 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| PIC86_RS06540 (1337320) | 1337320..1337892 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| PIC86_RS06545 (1338038) | 1338038..1338916 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| PIC86_RS06550 (1338933) | 1338933..1339967 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| PIC86_RS06555 (1340180) | 1340180..1340893 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| PIC86_RS06560 (1341047) | 1341047..1341274 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PIC86_RS06565 (1341274) | 1341274..1341672 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PIC86_RS06570 (1341819) | 1341819..1342682 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
| PIC86_RS06575 (1342697) | 1342697..1344712 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| PIC86_RS06580 (1344786) | 1344786..1345484 | + | 699 | WP_000679823.1 | esterase | - |
| PIC86_RS06585 (1345594) | 1345594..1345794 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T268263 WP_000911330.1 NZ_CP116169:1341274-1341672 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|