Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 90577..91220 Replicon plasmid pDETEC2
Accession NZ_CP116168
Organism Escherichia coli strain DETEC-P169

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag PID12_RS24375 Protein ID WP_001034044.1
Coordinates 90804..91220 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag PID12_RS24370 Protein ID WP_001261286.1
Coordinates 90577..90807 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PID12_RS24350 (87208) 87208..87963 - 756 WP_000852146.1 replication initiation protein RepE -
PID12_RS24355 (88685) 88685..89491 - 807 WP_000016970.1 site-specific integrase -
PID12_RS24360 (89492) 89492..89797 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
PID12_RS24365 (89799) 89799..90017 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
PID12_RS24370 (90577) 90577..90807 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PID12_RS24375 (90804) 90804..91220 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
PID12_RS24380 (91295) 91295..92860 + 1566 WP_001128474.1 AAA family ATPase -
PID12_RS24385 (92845) 92845..93867 + 1023 WP_000361402.1 helicase UvrD -
PID12_RS24390 (94121) 94121..94807 - 687 Protein_113 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(A) / aac(3)-IIa / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / tet(A) / sitABCD iutA / iucD / iucC / iucB / iucA 1..113066 113066
- flank IS/Tn - - 94121..94468 347


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T268257 WP_001034044.1 NZ_CP116168:90804-91220 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT268257 WP_001261286.1 NZ_CP116168:90577-90807 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References