Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 89492..90017 | Replicon | plasmid pDETEC2 |
| Accession | NZ_CP116168 | ||
| Organism | Escherichia coli strain DETEC-P169 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | PID12_RS24360 | Protein ID | WP_001159871.1 |
| Coordinates | 89492..89797 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | PID12_RS24365 | Protein ID | WP_000813630.1 |
| Coordinates | 89799..90017 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PID12_RS24345 (85454) | 85454..86620 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| PID12_RS24350 (87208) | 87208..87963 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| PID12_RS24355 (88685) | 88685..89491 | - | 807 | WP_000016970.1 | site-specific integrase | - |
| PID12_RS24360 (89492) | 89492..89797 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| PID12_RS24365 (89799) | 89799..90017 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| PID12_RS24370 (90577) | 90577..90807 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PID12_RS24375 (90804) | 90804..91220 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| PID12_RS24380 (91295) | 91295..92860 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| PID12_RS24385 (92845) | 92845..93867 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
| PID12_RS24390 (94121) | 94121..94807 | - | 687 | Protein_113 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mph(A) / aac(3)-IIa / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / tet(A) / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..113066 | 113066 | |
| - | flank | IS/Tn | - | - | 94121..94468 | 347 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T268256 WP_001159871.1 NZ_CP116168:c89797-89492 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |